|
BALL
1.4.1
|
This class provides methods for reading and assigning chemical shifts. More...
#include <BALL/FORMAT/NMRStarFile.h>
Classes | |
| class | BALLToBMRBMapper |
| class | EntryInformation |
| class | MolecularSystem |
| class | MonomericPolymer |
| class | NMRAtomData |
| class | NMRAtomDataSet |
| class | NMRSpectrometer |
| class | Sample |
| class | SampleCondition |
| class | ShiftReferenceElement |
| class | ShiftReferenceSet |
Public Member Functions | |
Constructors and Destructors | |
| NMRStarFile () | |
| NMRStarFile (const String &file_name, File::OpenMode open_mode=std::ios::in) | |
| ~NMRStarFile () | |
| Destructor. | |
Access methods | |
| bool | read () |
| bool | read (AtomContainer &ac) |
| bool | assignShifts (BALLToBMRBMapper &ball_to_bmrb_mapping) |
| bool | assignShifts (AtomContainer &ac, const String &chemical_unit, const String &aligned_ball_sequence, const String &aligned_nmrstar_sequence) |
| Size | getNumberOfAtoms () const |
| Size | getNumberOfShiftsAssigned () const |
| const std::vector < NMRAtomDataSet > & | getNMRData () const |
| const EntryInformation & | getEntryInformation () const |
| const MolecularSystem & | getMolecularInformation () const |
| MolecularSystem & | getMolecularInformation () |
| const MolecularSystem::ChemicalUnit & | getChemicalUnitByLabel (String const &label) const |
| MolecularSystem::ChemicalUnit & | getChemicalUnitByLabel (String const &label) |
| bool | hasSampleCondition (String name) |
| bool | hasSampleCondition (String name) const |
| SampleCondition & | getSampleConditionByName (String name) |
| const SampleCondition & | getSampleConditionByName (String name) const |
| SampleCondition & | getSampleCondition (Position i) |
| Get the i-th SampleCondition. | |
| const SampleCondition & | getSampleCondition (Position i) const |
| Get the i-th SampleCondition. | |
| Size | getNumberOfSampleConditions () const |
| Get the number of sample conditions. | |
| const std::vector < SampleCondition > & | getSampleConditions () const |
| Get the sample conditions. | |
| std::vector< SampleCondition > & | getSampleConditions () |
| Get the sample conditions. | |
| std::vector< Sample > | getSamples () const |
| Get the samples. | |
| Size | getNumberOfSamples () const |
| Get the number of samples. | |
| bool | hasSample (String label) const |
| Return true if the file contains a sample named label, false otherwise. | |
| Sample | getSample (Position i) const |
| Sample | getSample (String label) const |
| std::vector< ShiftReferenceSet > & | getShiftReferenceSets () |
| Get the shift reference sets. | |
| const std::vector < ShiftReferenceSet > & | getShiftReferenceSets () const |
| Get the shift reference sets. | |
| Size | getNumberOfShiftReferenceSets () const |
| Get the number of shift reference sets. | |
| bool | hasShiftReferenceSet (String name) |
| Check if there is a ShiftReferenceSet named name. | |
| ShiftReferenceSet & | getShiftReferenceSet (Position i) |
| Get the i-th shift reference set. | |
| const ShiftReferenceSet & | getShiftReferenceSet (Position i) const |
| Get the i-th shift reference set. | |
| const ShiftReferenceSet & | getShiftReferenceSetByName (String name) const |
| Get a ShiftReferenceSet by its SaveFrame name. | |
| ShiftReferenceSet & | getShiftReferenceSetByName (String name) |
| Get a ShiftReferenceSet by its SaveFrame name. | |
| std::vector< NMRSpectrometer > & | getNMRSpectrometers () |
| Get the spectrometers. | |
| const std::vector < NMRSpectrometer > & | getNMRSpectrometers () const |
| Get the spectrometers. | |
| Size | getNumberOfNMRSpectrometers () const |
| Get the number of nmr spectrometers. | |
| NMRSpectrometer & | getNMRSpectrometer (Position i) |
| Get the i-th spectrometer. | |
| const NMRSpectrometer & | getNMRSpectrometer (Position i) const |
| Get the i-th spectrometer. | |
| NMRSpectrometer & | getNMRSpectrometerByName (String name) |
| Get the spectrometer by its SaveFrame name. | |
| const NMRSpectrometer & | getNMRSpectrometerByName (String name) const |
| Get the spectrometer by its SaveFrame name. | |
| String | getNMRSpectrometerManufacturer (Position i) const |
| Get the spectrometer manufacturer. | |
| float | getNMRSpectrometerFieldStrength (Position i) const |
| Get the spectrometer field strength. | |
| NMRStarFile::MonomericPolymer & | getMonomericPolymer (Position i) |
| const NMRStarFile::MonomericPolymer & | getMonomericPolymer (Position i) const |
| NMRStarFile::MonomericPolymer & | getMonomericPolymer (const String &name) |
| const NMRStarFile::MonomericPolymer & | getMonomericPolymer (const String &name) const |
| Size | getNumberOfMonomericPolymers () const |
| Get the number of monomeric polymers in the file. | |
| vector< MonomericPolymer > | getMonomericPolymers () const |
| Get all Monomeric Polymers. | |
| bool | hasMonomericPolymer (String name) const |
| Check if polymer name is already stored is a monomeric polymer. | |
| bool | isMonomericPolymer (String chemical_unit_label) |
| void | addMonomericPolymer (MonomericPolymer mp) |
| String | getResidueSequence (Position i=0) const |
| bool | hasHshifts () const |
| Check, whether this NMRFile provides hydrogen shifts. | |
| bool | hasCshifts () const |
| Check, whether this NMRFile provides carbon shifts. | |
| bool | hasNshifts () const |
| Check, whether this NMRFile provides nitrogen shifts. | |
Equality | |
| bool | operator== (const NMRStarFile &f) |
| bool | operator!= (const NMRStarFile &f) |
| void | clear () |
Static Public Attributes | |
| static const float | FLOAT_VALUE_NA |
| static const int | INT_VALUE_NA |
| static const Position | POSITION_VALUE_NA |
Private Member Functions | |
| void | readEntryInformation_ () |
| reads the number of chemical shifts | |
| void | readMolSystem_ () |
| reads the molecular system name | |
| void | readMonomericPolymers_ () |
| read the MonomericPolymers | |
| void | readSampleConditions_ () |
| reads the sample conditions | |
| void | readShiftReferences_ () |
| reads the shift references | |
| void | readShifts_ () |
| reads the shift datas | |
| void | readSamples_ () |
| read the samples | |
| void | readNMRSpectrometer_ () |
| reads the NMR spectrometer data | |
| void | findDependiencies_ () |
| find dependencies for the ChemicalUnits | |
| void | setSpecialCharacters_ (String characters) |
| set the characters denoting single non-available values | |
| bool | isValidSingleValue_ (String value) |
| check whether the given String denotes a non-available value | |
| float | valueToFloat_ (String value) |
| returns the value as float, if it is a valid one, or FLOAT_VALUE_NA | |
| int | valueToInt_ (String value) |
| returns the value as int, if it is a valid one, or INT_VALUE_NA | |
| bool | assignShifts_ (BALLToBMRBMapper &pdb_to_bmrb_mapping) |
Private Attributes | |
| bool | valid_ |
| Size | number_of_shift_sets_ |
| the number of shift data sets | |
| Size | number_of_assigned_shifts_ |
| the number of assigned shifts during the last call of assignShifts() | |
| EntryInformation | entry_information_ |
| the general entry data | |
| MolecularSystem | molecular_system_ |
| the system information | |
| std::vector< NMRAtomDataSet > | atom_data_sets_ |
| the data for the atoms is stored here | |
| std::vector< SampleCondition > | sample_conditions_ |
| the data for different sample sets | |
| std::vector< Sample > | samples_ |
| the samples | |
| std::vector< ShiftReferenceSet > | shift_references_ |
| the data for shift references | |
| std::vector< NMRSpectrometer > | nmr_spectrometers_ |
| the data of nmr spectrometers | |
| vector< MonomericPolymer > | monomeric_polymers_ |
| Monomeric Polymer information. | |
| bool | has_H_shifts_ |
| stores, which shifts are given in the file | |
| bool | has_C_shifts_ |
| bool | has_N_shifts_ |
| SaveFrame | dummy_saveframe_ |
| SampleCondition | dummy_sample_condition_ |
| Sample | dummy_sample_ |
| ShiftReferenceSet | dummy_shift_reference_set_ |
| NMRSpectrometer | dummy_NMR_spectrometer_ |
| MonomericPolymer | dummy_monomeric_polymer_ |
| String | special_characters_ |
| characters, that denote non-available values | |
This class provides methods for reading and assigning chemical shifts.
NMRStarFile class.
This class provides methods for reading and assigning experimental chemical shifts from NMRStar files to peptides. The nested class BALLToBMRBMapper creates a mapping between NMRStar file atoms and atoms of a chain either based on a trivial mapping
Example code:
System system;
pdb_file >> system;
Chain& chain = *(system.beginChain());
NMRStarFile nmr_file("NMRStarFile_test.bmr");
cout << "File contains " << nmr_file.getNumberOfAtoms() << " chemical shifts" << endl;
cout << "Number of samples: " << nmr_file.getNumberOfSamples() << endl;
NMRStarFile::MolecularSystem nmr_mol_sys = nmr_file.getMolecularInformation();
cout << "Molecular systems name: " << nmr_mol_sys.system_name << endl;
cout << "Number of possible chemical units: " << nmr_mol_sys.getNumberOfChemicalUnits() << endl;
// the chemical units of this file
for (Size k=0; k < nmr_mol_sys.getNumberOfChemicalUnits(); k++)
{
NMRStarFile::MolecularSystem::ChemicalUnit cu = nmr_mol_sys.getChemicalUnit(k);
cout << " " << k << " : " << cu.component_name
<< " " << cu.label << endl;
}
// get the shift data
// NOTE: nmr_file.atom_data_sets_ equals nmr_data !
std::vector<NMRStarFile::NMRAtomDataSet> const& nmr_data = nmr_file.getNMRData();
cout << "Number of shift sets: " << nmr_data.size() << endl;
for (Size k=0; k < nmr_data.size(); k++)
{
cout << " " << k << " shift set name: " << nmr_data[k].name << " -- condition name: " << nmr_data[k].condition << endl;
}
// decide for a chemical unit
NMRStarFile::MolecularSystem::ChemicalUnit cu = nmr_mol_sys.getChemicalUnit(0);
String chemical_unit_label = cu.label;
cout << Peptides::GetSequence(chain) << endl;
cout << nmr_file.getResidueSequence() << endl;
// create a mapping based on an alignment
cout << "Create a mapping... " ;
NMRStarFile::BALLToBMRBMapper mapper(chain, nmr_file, chemical_unit_label);
mapper.createMapping("MKSTGIVRKVDELGR-VVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT",
"MKSTGIVRKVDELGRVV-IPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT");
cout << "Number of mismatches: " << mapper.getNumberOfMismatches() << endl;
cout << "Number of gaps: " << mapper.getNumberOfGaps() << endl;
// assign the shifts
nmr_file.assignShifts(mapper);
cout << "Assigned " << nmr_file.getNumberOfShiftsAssigned()
<< " shifts given " << nmr_file.getNumberOfAtoms() << " chemical shifts." << endl << endl;
...
cout << atom->getProperty(ShiftModule::PROPERTY__EXPERIMENTAL__SHIFT).getFloat() << endl;
...
// get the ChemicalUnit by label
NMRStarFile::MolecularSystem::ChemicalUnit chemical_unit = getChemicalUnitByLabel(chemical_unit_label);
// find the corresponding SampleCondition
if (chemical_unit.shifts && nmr_file.hasSampleCondition(chemical_unit.shifts->condition))
{
NMRStarFile::SampleCondition& condition = nmr_file.getSampleConditionByName(chemical_unit.shifts->condition);
if (condition.hasType("pH"))
pH = condition.values["pH"];
if (condition.hasType("pH*"))
pH = condition.values["pH*"];
if (condition.hasType("temperature"))
temperature = condition.values["temperature"];
if (condition.hasType("pressure"))
pressure = condition.values["pressure"];
cout << "NMR conditions: " << pH << ", " << temperature << ", " << pressure << endl;
}
Definition at line 117 of file NMRStarFile.h.
Standard constructor
| BALL::NMRStarFile::NMRStarFile | ( | const String & | file_name, |
| File::OpenMode | open_mode = std::ios::in |
||
| ) |
Detailed constuctor. Opens the given file and extracts all usefull data (Calls read ).
| Exception::FileNotFound | if the file could not be opened |
Destructor.
Add a Monomeric Polymer NOTE: if a poymer with the same name already exists, it will be overwritten!
| bool BALL::NMRStarFile::assignShifts | ( | BALLToBMRBMapper & | ball_to_bmrb_mapping | ) |
Assign the shifts to the given AtomContainer as denoted in the given {BALLToBMRBMapper}.
true if reading the file was successful | bool BALL::NMRStarFile::assignShifts | ( | AtomContainer & | ac, |
| const String & | chemical_unit, | ||
| const String & | aligned_ball_sequence, | ||
| const String & | aligned_nmrstar_sequence | ||
| ) |
Assign the shifts to the given AtomContainer as pointed out in the alignment. The alignmed sequences should be given in OneLetterCode, where '-' denotes a gap.
| ac | AtomContainer to which the NMRStarfile's shift should be assigned. |
| chemical_unit | the name of the molecular system (chemical unit) storing the atom shifts |
| aligned_ball_sequence | the aligned AtomContainers aminoacid sequence |
| aligned_nmrstar_sequence | the aligned aminoacid sequence of the NMRStar file atoms |
true if reading the file was successful | bool BALL::NMRStarFile::assignShifts_ | ( | BALLToBMRBMapper & | pdb_to_bmrb_mapping | ) | [private] |
Apply the shifts read into the AtomContainer as denoted in the mapping. We assume, that the file was already read! The shifts are stored as a property under the key {BALL::ShiftModule::PROPERTY__EXPERIMENTAL__SHIFT}
| void BALL::NMRStarFile::clear | ( | ) | [virtual] |
Clear the object.
Reimplemented from BALL::File.
| void BALL::NMRStarFile::findDependiencies_ | ( | ) | [private] |
find dependencies for the ChemicalUnits
| const MolecularSystem::ChemicalUnit& BALL::NMRStarFile::getChemicalUnitByLabel | ( | String const & | label | ) | const |
Get a chemical unit by name
| MolecularSystem::ChemicalUnit& BALL::NMRStarFile::getChemicalUnitByLabel | ( | String const & | label | ) |
Get a chemical unit by name
| const EntryInformation& BALL::NMRStarFile::getEntryInformation | ( | ) | const [inline] |
Get the entry information
Definition at line 682 of file NMRStarFile.h.
| const MolecularSystem& BALL::NMRStarFile::getMolecularInformation | ( | ) | const [inline] |
Get the molecular information
Definition at line 686 of file NMRStarFile.h.
| MolecularSystem& BALL::NMRStarFile::getMolecularInformation | ( | ) | [inline] |
Get the molecular information
Definition at line 690 of file NMRStarFile.h.
Get a mutable reference to the MonomericPolymer-information by index
| Exception::OutOfRange | if a polymer with this index could not be found |
| const NMRStarFile::MonomericPolymer& BALL::NMRStarFile::getMonomericPolymer | ( | Position | i | ) | const |
Get the MonomericPolymer-information by index
| Exception::OutOfRange | if a polymer with this index could not be found |
| NMRStarFile::MonomericPolymer& BALL::NMRStarFile::getMonomericPolymer | ( | const String & | name | ) |
Get a mutable reference to the MonomericPolymer-information by name
| Exception::OutOfRange | if a polymer with this name could not be found |
| const NMRStarFile::MonomericPolymer& BALL::NMRStarFile::getMonomericPolymer | ( | const String & | name | ) | const |
Get the MonomericPolymer-information by name
| Exception::OutOfRange | if a polymer with this name could not be found |
| vector<MonomericPolymer> BALL::NMRStarFile::getMonomericPolymers | ( | ) | const [inline] |
Get all Monomeric Polymers.
Definition at line 826 of file NMRStarFile.h.
| const std::vector<NMRAtomDataSet>& BALL::NMRStarFile::getNMRData | ( | ) | const |
Get the extracted data for the atoms
Get the i-th spectrometer.
| const NMRSpectrometer& BALL::NMRStarFile::getNMRSpectrometer | ( | Position | i | ) | const |
Get the i-th spectrometer.
Get the spectrometer by its SaveFrame name.
| const NMRSpectrometer& BALL::NMRStarFile::getNMRSpectrometerByName | ( | String | name | ) | const |
Get the spectrometer by its SaveFrame name.
Get the spectrometer field strength.
Get the spectrometer manufacturer.
| std::vector<NMRSpectrometer>& BALL::NMRStarFile::getNMRSpectrometers | ( | ) | [inline] |
Get the spectrometers.
Definition at line 778 of file NMRStarFile.h.
| const std::vector<NMRSpectrometer>& BALL::NMRStarFile::getNMRSpectrometers | ( | ) | const [inline] |
Get the spectrometers.
Definition at line 780 of file NMRStarFile.h.
| Size BALL::NMRStarFile::getNumberOfAtoms | ( | ) | const |
Return the maximum number of atoms in all shift sets
| Size BALL::NMRStarFile::getNumberOfMonomericPolymers | ( | ) | const [inline] |
Get the number of monomeric polymers in the file.
Definition at line 823 of file NMRStarFile.h.
| Size BALL::NMRStarFile::getNumberOfNMRSpectrometers | ( | ) | const [inline] |
Get the number of nmr spectrometers.
Definition at line 783 of file NMRStarFile.h.
| Size BALL::NMRStarFile::getNumberOfSampleConditions | ( | ) | const [inline] |
Get the number of sample conditions.
Definition at line 725 of file NMRStarFile.h.
| Size BALL::NMRStarFile::getNumberOfSamples | ( | ) | const [inline] |
Get the number of samples.
Definition at line 740 of file NMRStarFile.h.
| Size BALL::NMRStarFile::getNumberOfShiftReferenceSets | ( | ) | const [inline] |
Get the number of shift reference sets.
Definition at line 761 of file NMRStarFile.h.
| Size BALL::NMRStarFile::getNumberOfShiftsAssigned | ( | ) | const [inline] |
Return the number of atoms assigned a chemical shift
Definition at line 674 of file NMRStarFile.h.
| String BALL::NMRStarFile::getResidueSequence | ( | Position | i = 0 | ) | const |
Get the sequence of residues of the i-th monomeric polymer in the file.
This method automatically compares the i-th monomeric_polymers' residue sequence with the actual stored NMR shift data. If there is a mismatch, a warning is given! If there is a mismatch or there is no monomeric_polymers residue sequence an empty.
| Sample BALL::NMRStarFile::getSample | ( | Position | i | ) | const |
Get the i-th sample. If i is out of size a dummy sample is returned.
| Sample BALL::NMRStarFile::getSample | ( | String | label | ) | const |
Get the sample with name label. If no sample with name label exist a dummy sample is returned.
| SampleCondition& BALL::NMRStarFile::getSampleCondition | ( | Position | i | ) | [inline] |
Get the i-th SampleCondition.
Definition at line 719 of file NMRStarFile.h.
| const SampleCondition& BALL::NMRStarFile::getSampleCondition | ( | Position | i | ) | const [inline] |
Get the i-th SampleCondition.
Definition at line 722 of file NMRStarFile.h.
Get a SampleCondition by its SaveFrame name
| const SampleCondition& BALL::NMRStarFile::getSampleConditionByName | ( | String | name | ) | const |
Get a SampleCondition by its SaveFrame name
| const std::vector<SampleCondition>& BALL::NMRStarFile::getSampleConditions | ( | ) | const [inline] |
Get the sample conditions.
Definition at line 728 of file NMRStarFile.h.
| std::vector<SampleCondition>& BALL::NMRStarFile::getSampleConditions | ( | ) | [inline] |
Get the sample conditions.
Definition at line 731 of file NMRStarFile.h.
| std::vector<Sample> BALL::NMRStarFile::getSamples | ( | ) | const [inline] |
Get the samples.
Definition at line 736 of file NMRStarFile.h.
| ShiftReferenceSet& BALL::NMRStarFile::getShiftReferenceSet | ( | Position | i | ) | [inline] |
Get the i-th shift reference set.
Definition at line 767 of file NMRStarFile.h.
| const ShiftReferenceSet& BALL::NMRStarFile::getShiftReferenceSet | ( | Position | i | ) | const [inline] |
Get the i-th shift reference set.
Definition at line 769 of file NMRStarFile.h.
| const ShiftReferenceSet& BALL::NMRStarFile::getShiftReferenceSetByName | ( | String | name | ) | const |
Get a ShiftReferenceSet by its SaveFrame name.
Get a ShiftReferenceSet by its SaveFrame name.
| std::vector<ShiftReferenceSet>& BALL::NMRStarFile::getShiftReferenceSets | ( | ) | [inline] |
Get the shift reference sets.
Definition at line 756 of file NMRStarFile.h.
| const std::vector<ShiftReferenceSet>& BALL::NMRStarFile::getShiftReferenceSets | ( | ) | const [inline] |
Get the shift reference sets.
Definition at line 758 of file NMRStarFile.h.
| bool BALL::NMRStarFile::hasCshifts | ( | ) | const [inline] |
Check, whether this NMRFile provides carbon shifts.
Definition at line 859 of file NMRStarFile.h.
| bool BALL::NMRStarFile::hasHshifts | ( | ) | const [inline] |
Check, whether this NMRFile provides hydrogen shifts.
Definition at line 856 of file NMRStarFile.h.
| bool BALL::NMRStarFile::hasMonomericPolymer | ( | String | name | ) | const |
Check if polymer name is already stored is a monomeric polymer.
| bool BALL::NMRStarFile::hasNshifts | ( | ) | const [inline] |
Check, whether this NMRFile provides nitrogen shifts.
Definition at line 862 of file NMRStarFile.h.
| bool BALL::NMRStarFile::hasSample | ( | String | label | ) | const |
Return true if the file contains a sample named label, false otherwise.
Return true if the file contains a SampleCondition named name, false otherwise
| bool BALL::NMRStarFile::hasSampleCondition | ( | String | name | ) | const |
Return true if the file contains a SampleCondition named name, false otherwise
Check if there is a ShiftReferenceSet named name.
| bool BALL::NMRStarFile::isMonomericPolymer | ( | String | chemical_unit_label | ) |
Check if label is a monomeric polymer.
Returns true if a monomer with name chemical_unit_label exists, false otherwise.
| bool BALL::NMRStarFile::isValidSingleValue_ | ( | String | value | ) | [private] |
check whether the given String denotes a non-available value
| bool BALL::NMRStarFile::operator!= | ( | const NMRStarFile & | f | ) |
Inequality operator Test if both instances point to different files.
| bool BALL::NMRStarFile::operator== | ( | const NMRStarFile & | f | ) |
Equality operator. Test if both instances point to the same file.
| bool BALL::NMRStarFile::read | ( | ) | [virtual] |
Read an NMRStarFile.
| Exception::ParseError | if a syntax error was encountered |
Reimplemented from BALL::CIFFile.
| bool BALL::NMRStarFile::read | ( | AtomContainer & | ac | ) |
| void BALL::NMRStarFile::readEntryInformation_ | ( | ) | [private] |
reads the number of chemical shifts
| void BALL::NMRStarFile::readMolSystem_ | ( | ) | [private] |
reads the molecular system name
| void BALL::NMRStarFile::readMonomericPolymers_ | ( | ) | [private] |
read the MonomericPolymers
| void BALL::NMRStarFile::readNMRSpectrometer_ | ( | ) | [private] |
reads the NMR spectrometer data
| void BALL::NMRStarFile::readSampleConditions_ | ( | ) | [private] |
reads the sample conditions
| void BALL::NMRStarFile::readSamples_ | ( | ) | [private] |
read the samples
| void BALL::NMRStarFile::readShiftReferences_ | ( | ) | [private] |
reads the shift references
| void BALL::NMRStarFile::readShifts_ | ( | ) | [private] |
reads the shift datas
| void BALL::NMRStarFile::setSpecialCharacters_ | ( | String | characters | ) | [private] |
set the characters denoting single non-available values
| float BALL::NMRStarFile::valueToFloat_ | ( | String | value | ) | [private] |
returns the value as float, if it is a valid one, or FLOAT_VALUE_NA
| int BALL::NMRStarFile::valueToInt_ | ( | String | value | ) | [private] |
returns the value as int, if it is a valid one, or INT_VALUE_NA
std::vector<NMRAtomDataSet> BALL::NMRStarFile::atom_data_sets_ [private] |
the data for the atoms is stored here
Definition at line 961 of file NMRStarFile.h.
Definition at line 999 of file NMRStarFile.h.
Definition at line 996 of file NMRStarFile.h.
Sample BALL::NMRStarFile::dummy_sample_ [private] |
Definition at line 990 of file NMRStarFile.h.
Definition at line 987 of file NMRStarFile.h.
SaveFrame BALL::NMRStarFile::dummy_saveframe_ [private] |
Definition at line 984 of file NMRStarFile.h.
Definition at line 993 of file NMRStarFile.h.
the general entry data
Definition at line 955 of file NMRStarFile.h.
const float BALL::NMRStarFile::FLOAT_VALUE_NA [static] |
Definition at line 123 of file NMRStarFile.h.
bool BALL::NMRStarFile::has_C_shifts_ [private] |
Definition at line 980 of file NMRStarFile.h.
bool BALL::NMRStarFile::has_H_shifts_ [private] |
stores, which shifts are given in the file
Definition at line 979 of file NMRStarFile.h.
bool BALL::NMRStarFile::has_N_shifts_ [private] |
Definition at line 981 of file NMRStarFile.h.
const int BALL::NMRStarFile::INT_VALUE_NA [static] |
Definition at line 124 of file NMRStarFile.h.
the system information
Definition at line 958 of file NMRStarFile.h.
vector<MonomericPolymer> BALL::NMRStarFile::monomeric_polymers_ [private] |
Monomeric Polymer information.
Definition at line 976 of file NMRStarFile.h.
std::vector<NMRSpectrometer> BALL::NMRStarFile::nmr_spectrometers_ [private] |
the data of nmr spectrometers
Definition at line 973 of file NMRStarFile.h.
the number of assigned shifts during the last call of assignShifts()
Definition at line 952 of file NMRStarFile.h.
Size BALL::NMRStarFile::number_of_shift_sets_ [private] |
the number of shift data sets
Definition at line 949 of file NMRStarFile.h.
const Position BALL::NMRStarFile::POSITION_VALUE_NA [static] |
Definition at line 126 of file NMRStarFile.h.
std::vector<SampleCondition> BALL::NMRStarFile::sample_conditions_ [private] |
the data for different sample sets
Definition at line 964 of file NMRStarFile.h.
std::vector<Sample> BALL::NMRStarFile::samples_ [private] |
the samples
Definition at line 967 of file NMRStarFile.h.
std::vector<ShiftReferenceSet> BALL::NMRStarFile::shift_references_ [private] |
the data for shift references
Definition at line 970 of file NMRStarFile.h.
String BALL::NMRStarFile::special_characters_ [private] |
characters, that denote non-available values
Definition at line 1002 of file NMRStarFile.h.
bool BALL::NMRStarFile::valid_ [private] |
Definition at line 946 of file NMRStarFile.h.
1.7.6.1